BioLiP

>protein
CAEFRIKYVGAIEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTVLHRHALYLIIRMVCYDDGLGAGKSLL
ALKTTASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT

The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4jif:A	130	130	0.9833	0.9077	0.9077	4.42e-79	4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y
2	4dx9:0	110	120	0.9167	1.0000	0.9167	2.55e-71	4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U
3	4dx9:O	102	122	0.8000	0.9412	0.7869	3.10e-58	4dx9:a
4	4dx9:y	93	119	0.7667	0.9892	0.7731	1.10e-51
5	4dx9:2	91	120	0.7500	0.9890	0.7500	7.04e-50
6	4dx9:o	63	120	0.5083	0.9683	0.5083	3.58e-17
7	6st5:A	913	30	0.1000	0.0131	0.4000	0.45
8	2p0a:A	298	66	0.1417	0.0570	0.2576	3.1	2p0a:B
9	4c4a:A	641	31	0.0917	0.0172	0.3548	5.5	6ogn:A
10	8unf:A	187	50	0.1417	0.0909	0.3400	5.5	3u5z:A, 3u5z:K, 3u60:A, 8uh7:A, 8uk9:A, 8uk9:Q
11	6tgv:C	389	37	0.1167	0.0360	0.3784	6.5	8ow5:A, 8ow5:B, 8ow5:C, 8ow5:D, 8owb:A, 8owb:B, 8owb:C, 8owb:D, 8owp:A, 8owp:B, 8owp:C, 8owp:D, 8owq:A, 8owq:B, 8owq:C, 8owq:D, 8owr:A, 8owr:C, 8owr:D, 4qji:A, 4qji:B, 6tgv:A, 6tgv:B, 6tgv:D, 6th2:A, 6th2:C, 6thc:A, 6thc:B, 6thc:C, 6thc:D
12	3a31:A	465	28	0.0833	0.0215	0.3571	8.5	3a32:A
13	7mq8:LU	445	74	0.1417	0.0382	0.2297	9.8	7mq9:LU, 7mqa:LU
14	6nf1:A	550	42	0.1083	0.0236	0.3095	9.8	3bji:A, 3bji:B, 3ky9:A, 3ky9:B, 6new:A, 6nfa:A, 2vrw:B

[Back]