AVSTRLEAEALTASSGVIKSNADASGGQYRIFNAYGVAEQIDYAVPVSHAGAYDLVLGTMRFSDNGTYQLQIDGNDVGAP
VDLFRPSGKVVVVDLGSVTLSAGVHEFTFTAVGKNTSSLGYKLPLDYIQLVSA
The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ehg:E | 136 | 133 | 1.0000 | 0.9779 | 1.0000 | 5.10e-94 | 7ehg:A, 7ehg:B, 7ehg:C, 7ehg:D, 7ehg:F, 7ehg:G, 7ehg:H |
2 | 6f2p:A | 1040 | 132 | 0.3609 | 0.0462 | 0.3636 | 1.27e-16 | |
3 | 7mq8:SP | 1993 | 57 | 0.1504 | 0.0100 | 0.3509 | 0.17 | 7mq9:SP |
4 | 7mqa:SP | 2485 | 57 | 0.1504 | 0.0080 | 0.3509 | 0.17 | |
5 | 2cdo:A | 138 | 99 | 0.1955 | 0.1884 | 0.2626 | 0.57 | 2cdo:D, 2cdo:C, 2cdo:B, 2cdp:A, 2cdp:D, 2cdp:B, 2cdp:C |
6 | 5mr0:D | 290 | 102 | 0.1729 | 0.0793 | 0.2255 | 0.68 | 5mr0:A, 5mr0:B, 5mr0:C, 5mr0:E, 5mr0:F |
7 | 7mdh:B | 360 | 45 | 0.1128 | 0.0417 | 0.3333 | 1.7 | 7mdh:A, 7mdh:C, 7mdh:D |
8 | 5kvp:A | 159 | 49 | 0.1353 | 0.1132 | 0.3673 | 3.2 | |
9 | 8kdb:A | 2117 | 32 | 0.1053 | 0.0066 | 0.4375 | 3.6 | 8kdc:A |
10 | 4im7:A | 483 | 29 | 0.0827 | 0.0228 | 0.3793 | 7.5 | |
11 | 7p43:B | 690 | 35 | 0.0977 | 0.0188 | 0.3714 | 9.1 | 7p43:A |