BioLiP

>protein
ATPSLRGRLARFANPGKPILKPNKPLILANRVGNRRREKGEATCITEMSMMMACWKQNEFRDEACRKEIQDFFDCSSRAQ
EARKMRSIQESLGQSESLSPHKMTKLLQRFPNKSHLI

The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7pnw:2	117	117	1.0000	1.0000	1.0000	8.57e-85
2	3jd5:m	118	116	0.8205	0.8136	0.8276	3.58e-68	5aj3:m, 5aj4:Am, 6gaw:Am, 6gaz:Am, 6neq:m, 6nf8:m, 7nqh:Am, 7nql:Am, 7nsi:Am, 7nsj:Am, 8oin:Ac, 8oip:Ac, 6ydp:Am, 6ydw:Am
3	8any:A2	117	116	0.8291	0.8291	0.8362	2.86e-64	7a5f:c6, 7a5g:c6, 7a5i:c6, 7a5k:c6, 3j9m:A2, 8k2a:Sm, 7l08:A2, 6nu2:A2, 6nu3:A2, 7og4:A2, 8oir:Ac, 8ois:Ac, 7p2e:2, 7po1:2, 7po2:2, 7po3:2, 7qi4:A2, 7qi5:A2, 7qi6:A2, 8qrm:2, 8qrn:2, 6rw4:2, 6rw5:2, 6vlz:A2, 6vmi:A2, 8xt0:Sm, 8xt2:Sm, 6zm5:A2, 6zm6:A2, 6zs9:A2, 6zsa:A2, 6zsb:A2, 6zsc:A2, 6zsd:A2, 6zse:A2, 6zsg:A2
4	6yw5:11	88	47	0.1368	0.1818	0.3404	0.16	6ywe:11, 6ywx:11, 6ywy:11
5	6z6b:PPP	2036	59	0.1624	0.0093	0.3220	0.25	6z6b:EEE
6	7orj:A	2129	47	0.1197	0.0066	0.2979	0.40
7	8om2:Z	92	77	0.1624	0.2065	0.2468	1.4	8d8k:Z, 8d8l:Z, 5mrc:ZZ, 5mre:ZZ, 5mrf:ZZ, 8om3:Z, 8om4:Z
8	6z6g:A	2142	58	0.1538	0.0084	0.3103	1.4	5amr:A
9	7orl:A	2183	43	0.1282	0.0069	0.3488	3.8	7oa4:AAA, 7oa4:BBB, 7oa4:DDD, 7oa4:GGG, 7ork:A, 7plr:AAA, 7plr:BBB, 7plr:DDD, 7plr:GGG, 2xi5:A, 2xi5:B, 2xi5:C, 2xi5:D, 2xi7:A, 2xi7:B, 2xi7:C, 2xi7:D
10	6z8k:A	2158	43	0.1282	0.0070	0.3488	4.0	5amq:A, 7orn:A

[Back]