BioLiP

>protein
ATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPT
AIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIG
RMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLK
PAVLERQRKSKGVP

The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1nlf:B	254	254	1.0000	1.0000	1.0000	0.0
2	1j70:A	512	69	0.0709	0.0352	0.2609	0.43	1g8f:A, 1g8g:A, 1g8g:B, 1g8h:A, 1g8h:B, 1j70:B, 1j70:C, 1jec:A, 1jed:A, 1jed:B, 1jee:A, 1jee:B, 1r6x:A
3	5x7o:A	1247	43	0.0669	0.0136	0.3953	0.78	5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B
4	1o7k:A	124	28	0.0551	0.1129	0.5000	0.88	1o7k:B, 1o7k:C
5	2ixf:A	255	90	0.1142	0.1137	0.3222	2.5	2ixe:A, 2ixe:D, 2ixf:B, 2ixf:C, 2ixf:D, 2ixg:A, 4k8o:A
6	1oq6:A	76	29	0.0512	0.1711	0.4483	2.9
7	7wiv:A	571	34	0.0669	0.0298	0.5000	3.0	7wiw:A, 7wix:A
8	2oap:2	503	97	0.0945	0.0477	0.2474	3.2	2oap:1, 2oaq:2
9	3t37:A	509	41	0.0669	0.0334	0.4146	6.0	4ha6:A
10	7n65:H	107	46	0.0472	0.1121	0.2609	6.2	7n65:L
11	8t4j:A	552	40	0.0787	0.0362	0.5000	6.8	1jj7:A, 8t4e:A, 8t4f:A, 8t4g:A, 8t4h:A, 8t4i:A
12	6bhu:A	1328	102	0.1142	0.0218	0.2843	7.1	5uja:A, 6uy0:A
13	8f4b:A	1182	102	0.1142	0.0245	0.2843	7.1
14	8t4e:B	551	35	0.0709	0.0327	0.5143	8.2	8t4f:B, 8t4g:B, 8t4h:B, 8t4i:B, 8t4j:B
15	8cs9:Q	390	58	0.0748	0.0487	0.3276	9.8	8cs9:L, 8csx:L, 8csx:Q, 8cte:L, 8cte:Q, 7uzq:L, 7uzq:Q, 7v0k:L, 7v0k:Q, 7v0s:L, 7v0s:Q

[Back]