ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRF
GRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCT
TGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPT
The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bal:A | 207 | 206 | 0.9951 | 0.9903 | 0.9951 | 8.34e-152 | 4bar:A, 6c6w:A, 6e0d:A, 3e3s:A, 5jvx:A, 5l4r:A, 2pe7:A, 5sw1:A, 5t3g:A, 4tvt:A |
2 | 4bps:A | 331 | 40 | 0.0777 | 0.0483 | 0.4000 | 0.58 | |
3 | 6zn1:AAA | 400 | 112 | 0.1359 | 0.0700 | 0.2500 | 1.3 | 6zjh:AAA, 6zmz:AAA |
4 | 2ynm:D | 488 | 81 | 0.1019 | 0.0430 | 0.2593 | 2.4 | |
5 | 7yp9:D | 1285 | 52 | 0.0825 | 0.0132 | 0.3269 | 3.8 | |
6 | 6dii:H | 616 | 100 | 0.1311 | 0.0438 | 0.2700 | 3.8 | 6dii:A, 6dii:B, 6dii:C, 6dii:D, 6dii:E, 6dii:F, 6dii:G, 6dii:I, 6dii:J, 6dii:K, 6dii:L, 8ey1:D, 8ey1:F, 8ey1:H, 8ey1:J, 8ey1:L, 8ey9:B, 8ey9:E, 8ey9:F, 8ey9:G, 8ey9:H, 8ey9:I |
7 | 5x45:B | 137 | 18 | 0.0534 | 0.0803 | 0.6111 | 5.7 | 5x45:A, 5x45:C, 5x45:D |
8 | 7ara:A | 139 | 18 | 0.0534 | 0.0791 | 0.6111 | 7.4 | 7ara:B, 2hrv:A, 2hrv:B |