ASCGSGNFNKTAAKGVEFSAVAGDCIKYNKSSGTLQIGSWTGVASSYNITSGPQGITNTGNGWTTVANAANGDLYIKIVS
ASRSFNVKFDNW
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5kle:A | 95 | 92 | 1.0000 | 0.9684 | 1.0000 | 6.13e-62 | 5klf:A |
2 | 2xz4:A | 165 | 64 | 0.2065 | 0.1152 | 0.2969 | 2.2 | |
3 | 2dr1:A | 381 | 51 | 0.1739 | 0.0420 | 0.3137 | 4.7 | 2dr1:B |
4 | 4f0a:B | 294 | 48 | 0.1522 | 0.0476 | 0.2917 | 5.4 | |
5 | 5yzg:D | 1908 | 26 | 0.1087 | 0.0052 | 0.3846 | 5.4 | 6ahd:D, 8bc8:B, 8bc9:B, 8bca:B, 8bcb:B, 8bcc:B, 8bcd:B, 8bce:B, 8bcf:B, 8bcg:B, 8bch:B, 7bdi:B, 7bdj:B, 7bdk:B, 7bdl:B, 4f92:B, 4f93:B, 6ff7:r, 8h6k:5D, 8h6l:5D, 4kit:B, 5o9z:C, 7os1:B, 8qo9:B, 8qzs:B, 5urj:A, 5urk:A, 5urm:A, 5urm:B, 5xjc:D |
6 | 6iaa:A | 815 | 32 | 0.1413 | 0.0160 | 0.4062 | 8.2 | 6iaa:B |