ARKWFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRVPFAPG
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ruq:A | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 1.16e-42 | 7ruq:C |
2 | 7rup:A | 63 | 62 | 0.8095 | 0.8095 | 0.8226 | 1.13e-36 | |
3 | 3fma:C | 86 | 59 | 0.3810 | 0.2791 | 0.4068 | 2.30e-10 | 3fma:A, 3fma:B, 3fma:D, 3fma:E |
4 | 1l2z:A | 62 | 30 | 0.1587 | 0.1613 | 0.3333 | 0.18 | |
5 | 6tbu:A | 842 | 27 | 0.1905 | 0.0143 | 0.4444 | 2.8 | |
6 | 7wr7:B | 235 | 23 | 0.1746 | 0.0468 | 0.4783 | 4.2 | 6zov:A, 6zov:B, 6zov:C, 6zov:D |
7 | 1jft:A | 340 | 33 | 0.1746 | 0.0324 | 0.3333 | 6.3 | 1bdh:A, 1bdi:A, 1jfs:A, 1jh9:A, 1pnr:A, 2pua:A, 2pub:A, 2puc:A, 2pud:A, 2pue:A, 2puf:A, 2pug:A, 1qp0:A, 1qp4:A, 1qp7:A, 1qpz:A, 1qqa:A, 1qqb:A, 1vpw:A, 1wet:A, 1zay:A |
8 | 7kpj:E | 218 | 20 | 0.1429 | 0.0413 | 0.4500 | 7.7 | 7kpj:F |
9 | 8x7u:D | 654 | 33 | 0.1587 | 0.0153 | 0.3030 | 9.4 | 8x7u:E, 8x7u:C, 8x7u:B, 8x7u:F, 8x7u:A |