AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRL
ASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRT
FLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zfu:A | 212 | 212 | 1.0000 | 1.0000 | 1.0000 | 7.81e-157 | 2zfu:B |
2 | 5gm2:K | 267 | 140 | 0.2075 | 0.1648 | 0.3143 | 1.50e-05 | |
3 | 5gm2:B | 282 | 106 | 0.1651 | 0.1241 | 0.3302 | 0.002 | 5gm1:A, 5gm1:B, 5gm1:C, 5gm1:D, 5gm1:E, 5gm1:F, 5gm1:G, 5gm1:H, 5gm1:I, 5gm1:J, 5gm1:K, 5gm1:L, 5gm1:M, 5gm1:N, 5gm1:O, 5gm1:P, 5gm1:Q, 5gm1:R, 5gm2:A, 5gm2:C, 5gm2:D, 5gm2:E, 5gm2:F, 5gm2:G, 5gm2:H, 5gm2:I, 5gm2:J, 5gm2:L, 5gm2:M, 5gm2:N, 5gm2:O, 5gm2:P, 5gm2:Q, 5gm2:R |
4 | 2yqz:A | 261 | 57 | 0.1179 | 0.0958 | 0.4386 | 0.022 | 2yqz:B |
5 | 4pne:B | 272 | 104 | 0.1462 | 0.1140 | 0.2981 | 0.027 | 4pne:A |
6 | 1wg8:A | 281 | 133 | 0.1651 | 0.1246 | 0.2632 | 0.16 | 1wg8:B |
7 | 3la3:A | 198 | 68 | 0.0896 | 0.0960 | 0.2794 | 0.26 | 8h3v:X, 8h3v:Y, 8h40:X, 8h40:Y, 3la2:A, 3la2:B, 3la3:B |
8 | 4ww9:A | 238 | 120 | 0.1698 | 0.1513 | 0.3000 | 0.35 | 4ww5:A, 4ww7:A |
9 | 3w0l:B | 598 | 90 | 0.1179 | 0.0418 | 0.2778 | 0.49 | 3w0l:D |
10 | 7fbo:A | 282 | 53 | 0.0849 | 0.0638 | 0.3396 | 0.62 | 7fbh:B, 7fbh:C, 7fbo:B, 7fbo:C |
11 | 1z7z:3 | 192 | 32 | 0.0566 | 0.0625 | 0.3750 | 0.63 | |
12 | 5x62:B | 387 | 35 | 0.0708 | 0.0388 | 0.4286 | 1.5 | 5x62:A |
13 | 6dt1:A | 464 | 49 | 0.0708 | 0.0323 | 0.3061 | 1.6 | 6dt1:E |
14 | 1qzz:A | 340 | 86 | 0.1132 | 0.0706 | 0.2791 | 1.6 | 1r00:A, 1xds:A, 1xds:B, 1xdu:A |
15 | 4f86:A | 275 | 46 | 0.0708 | 0.0545 | 0.3261 | 1.7 | 4f84:A, 4f86:B, 4f86:C, 4f86:E, 4f86:F, 4f86:H, 4f86:I, 4f86:J, 4f86:K, 4f86:L |
16 | 3bus:A | 251 | 60 | 0.1085 | 0.0916 | 0.3833 | 2.0 | 3bus:B |
17 | 1i9g:A | 264 | 64 | 0.0991 | 0.0795 | 0.3281 | 2.2 | |
18 | 2gs9:A | 211 | 43 | 0.0802 | 0.0806 | 0.3953 | 3.7 | 2gs9:B |
19 | 4obw:D | 235 | 60 | 0.0991 | 0.0894 | 0.3500 | 3.8 | 4obw:A, 4obw:C, 4obw:B |
20 | 5yf0:B | 351 | 85 | 0.0896 | 0.0541 | 0.2235 | 3.8 | 5yf0:A, 5yf1:A, 5yf1:B, 5yf2:A, 5yf2:B |
21 | 6cx6:B | 333 | 41 | 0.0708 | 0.0450 | 0.3659 | 4.7 | 6cx6:A, 5eg5:A, 4fr0:A, 4fsd:A, 4kw7:A, 4rsr:A |
22 | 5v96:A | 467 | 27 | 0.0519 | 0.0236 | 0.4074 | 5.5 | 5v96:B, 5v96:C, 5v96:D |
23 | 4zwu:A | 435 | 54 | 0.0708 | 0.0345 | 0.2778 | 5.8 | 3l24:A, 3l7g:A, 4zwo:A, 4zwo:B, 4zwp:A, 4zwp:B, 4zwu:B |
24 | 7tj9:A | 1111 | 53 | 0.0896 | 0.0171 | 0.3585 | 5.8 | |
25 | 3l24:B | 417 | 54 | 0.0708 | 0.0360 | 0.2778 | 6.0 | 3l24:C, 3l7g:B, 3l7g:C |
26 | 7v6h:A | 267 | 81 | 0.1085 | 0.0861 | 0.2840 | 6.7 | 7v6h:B |