AQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQY
QVN
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5u6l:A | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 4.08e-60 | |
2 | 2e5s:A | 98 | 76 | 0.8193 | 0.6939 | 0.8947 | 1.86e-49 | 3d2q:A, 3d2q:B, 3d2q:C, 3d2q:D, 3d2s:A, 3d2s:B, 3d2s:C, 3d2s:D |
3 | 5u6h:A | 92 | 67 | 0.4217 | 0.3804 | 0.5224 | 1.43e-23 | 3d2n:A, 5u9b:A |
4 | 2rpp:A | 89 | 67 | 0.4096 | 0.3820 | 0.5075 | 3.45e-23 | |
5 | 2rpp:A | 89 | 37 | 0.1928 | 0.1798 | 0.4324 | 0.004 | |
6 | 6dnh:C | 117 | 63 | 0.2289 | 0.1624 | 0.3016 | 0.009 | 8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C |
7 | 2d9n:A | 77 | 75 | 0.2651 | 0.2857 | 0.2933 | 0.014 | 2rhk:C |
8 | 6dzi:v | 116 | 80 | 0.3012 | 0.2155 | 0.3125 | 0.063 | 6dzk:M, 8fr8:j, 5o5j:M, 5o61:BM, 8v9j:m, 8v9k:m, 8v9l:m, 8whx:n, 8wi7:n, 8wi9:n, 8wib:n, 8wid:n, 8wif:n, 5xyu:M, 5zeb:m, 5zep:m, 5zeu:m |
9 | 8dd5:A | 272 | 26 | 0.1325 | 0.0404 | 0.4231 | 1.2 | 1m36:A, 2ozu:A, 2rc4:A |
10 | 1yuh:H | 218 | 17 | 0.1084 | 0.0413 | 0.5294 | 9.4 | 1yuh:B |
11 | 4cs7:C | 172 | 20 | 0.1205 | 0.0581 | 0.5000 | 9.7 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |