AQESPAFIDPASWNTPFNGIAQVACHNCYEKQYANTFSSVLDSVRTLELDFWDQRDAVSGGSPHHWFVRHNPGTLFQSGN
DNNCTGGKNDLEACLNDVKNWSDKHPGHFPITLILDKKQGWSKESSGRTPKDFDELVARVFQGKLFTPQDLATHIGSGAG
ALQGNLKGKSWPTANDLQGKVLLVLNHSENQKLSQYAEARTSKAKVFISPVTNGQNDISGKVSGMSSQSSGYVAMNNMGK
GDKSWAKQAFAYSHIGRVWGDDEVSFAQHINQKINLSAYYRFAAQSAGGYRIRPF
The query sequence (length=295) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fyo:A | 298 | 298 | 1.0000 | 0.9899 | 0.9899 | 0.0 | 5fyo:B, 5fyp:A, 5fyp:B, 5fyp:C, 5fyp:D, 5fyr:A, 5fyr:B, 5fyr:C, 5fyr:D |
2 | 7l6x:A | 256 | 98 | 0.0644 | 0.0742 | 0.1939 | 0.71 | 6bqd:A, 6bqd:B, 6df4:A, 6df7:A, 6df7:B, 6fic:T, 5i1q:A, 5i29:A, 7jjg:A, 7jsp:A, 7jtc:A, 7k03:A, 7k0d:A, 7k0u:A, 7k0u:B, 7k1p:A, 7k27:A, 7lb0:A, 7lb1:A, 7lb2:A, 7lb3:A, 5mg2:A, 7n42:A, 6p38:A, 6p39:A, 6p3a:A, 6p3a:B, 7p4s:A, 7t2i:A, 7t36:A, 4yym:A, 4yym:B, 4yyn:A, 4yyn:B |
3 | 8jh1:B | 462 | 85 | 0.0814 | 0.0519 | 0.2824 | 0.80 | 8jbb:A, 8jbb:B, 8jh1:A |
4 | 4bqh:A | 521 | 67 | 0.0678 | 0.0384 | 0.2985 | 1.9 | |
5 | 4ut6:M | 107 | 37 | 0.0373 | 0.1028 | 0.2973 | 4.6 | 4ut6:L |
6 | 7vr4:A | 340 | 40 | 0.0508 | 0.0441 | 0.3750 | 7.8 | |
7 | 6sml:B | 911 | 51 | 0.0542 | 0.0176 | 0.3137 | 9.6 | 6sli:B, 6sli:D, 6sli:G, 6sli:J, 6slj:B, 6slj:A, 6sln:B, 6sln:A, 6sm3:B, 6smq:B, 6smq:E |