BioLiP

>protein
APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWED
VGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRT
DSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY

The query sequence (length=197) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ee6:A	197	197	1.0000	1.0000	1.0000	9.49e-146
2	4yz0:A	198	179	0.4924	0.4899	0.5419	2.79e-65	4ew9:A, 4ew9:B, 3t9g:A, 3t9g:B, 4yz0:B, 4yza:A, 4yza:B, 4yzq:A, 4yzq:B, 4yzx:A, 4yzx:B, 4z03:A, 4z03:B, 4z05:A, 4z05:B, 4z06:A, 4z06:B
3	3b8y:B	294	100	0.2284	0.1531	0.4500	2.81e-11
4	3b4n:A	314	111	0.2335	0.1465	0.4144	3.28e-11	3b4n:B, 3b8y:A, 3b90:A, 3b90:B
5	4u49:B	318	114	0.2335	0.1447	0.4035	2.52e-09
6	5z16:B	739	101	0.1675	0.0447	0.3267	0.39	5z16:A
7	4ccv:A	115	51	0.0812	0.1391	0.3137	1.1
8	1vs1:D	271	32	0.0660	0.0480	0.4062	1.4	1vs1:A, 1vs1:B, 1vs1:C
9	3he3:A	366	114	0.1371	0.0738	0.2368	2.0	3hdq:A, 3hdq:B, 3hdq:C, 3hdq:D, 3hdq:E, 3hdq:F, 3hdq:G, 3hdq:H, 3hdq:I, 3hdq:J, 3hdy:A, 3hdy:B, 3hdy:C, 3hdy:D, 3hdy:E, 3hdy:F, 3hdy:G, 3hdy:H, 3hdy:I, 3hdy:J, 3he3:B, 3he3:C, 3he3:D, 3he3:E, 3he3:F, 3he3:G, 3he3:H, 3he3:I, 3he3:J, 3mj4:A, 3mj4:B, 3mj4:C, 3mj4:D, 3mj4:E, 3mj4:F, 3mj4:G, 3mj4:H, 3mj4:I, 3mj4:J
10	1itw:A	740	124	0.1726	0.0459	0.2742	4.7	1itw:B, 1itw:C, 1itw:D, 1j1w:A, 1j1w:B, 1j1w:C, 1j1w:D
11	7wrg:B	783	71	0.0964	0.0243	0.2676	5.7
12	5n29:A	265	42	0.0711	0.0528	0.3333	6.8
13	6t1z:A	393	27	0.0609	0.0305	0.4444	8.1
14	7x9e:B	211	22	0.0660	0.0616	0.5909	9.3	7x9e:D

[Back]