BioLiP

>protein
APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTDPELNDEDLFHRLEKPNPHSGTFARMQL
FVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAH

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5a39:B	115	113	1.0000	0.9826	1.0000	4.47e-82	5a39:A, 5a3d:A, 5a3d:B, 5g32:A, 5g32:B, 5g33:A, 5g33:B, 5g34:A, 5g34:B, 5g35:A, 5g35:B, 5lcl:A, 5lcl:B, 5lcm:A, 5lcm:B
2	8ebt:K	172	100	0.2832	0.1860	0.3200	1.96e-11	7ad8:G, 8ebu:K, 8ebx:K, 8eby:K, 6j44:A, 6lae:A, 6lae:B, 6ro4:G, 1xpa:A
3	6r2q:A	265	70	0.1770	0.0755	0.2857	0.005
4	4lmh:D	695	58	0.1504	0.0245	0.2931	1.7	4lmh:A, 4lmh:B, 4lmh:C
5	1lss:A	132	67	0.1770	0.1515	0.2985	1.9	1lss:B, 1lss:C, 1lss:D
6	6fz1:A	392	18	0.0885	0.0255	0.5556	2.3	6a12:A, 3auk:A, 7buk:A, 7buk:B, 5ce5:A, 2dsn:A, 2dsn:B, 7ey3:A, 7ey3:B, 4fdm:A, 4fkb:A, 4fkb:B, 4fmp:A, 4fmp:B, 6fz7:A, 6fz8:A, 6fz9:A, 6fza:A, 6fzc:A, 6fzd:A, 1ji3:A, 1ji3:B, 1ku0:A, 1ku0:B, 6s3g:A, 6s3j:A, 6s3v:A, 3umj:A, 3umj:B, 2w22:A, 4x6u:A, 4x71:A, 4x7b:A, 4x85:A, 5xpx:A, 5xpx:E, 2z5g:A, 2z5g:B
7	6neq:z	207	70	0.1327	0.0725	0.2143	7.7	6nf8:z, 7p2e:8, 7po0:8, 7po1:8, 8qrm:8, 6rw4:8, 6rw5:8

[Back]