BioLiP

>protein
AMRKDAKAPYVTVFDERDGCGGPTKAGGNSGDNKGLCVKVAMKKVAYGEGGVDRIGEMARDVFVNYDKQRGK

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ssf:A	72	72	1.0000	1.0000	1.0000	1.85e-47	7ssf:C, 7ssf:E, 7ssf:G
2	4lm6:A	62	65	0.3889	0.4516	0.4308	7.17e-12	4lm6:C
3	7s96:A	63	68	0.4444	0.5079	0.4706	4.71e-11	7s96:C, 7s97:C, 7t89:A, 7t89:C
4	4lmx:C	66	49	0.3750	0.4091	0.5510	3.77e-10	8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
5	4lmx:E	66	47	0.3750	0.4091	0.5745	6.30e-10	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
6	7tja:I	75	49	0.2778	0.2667	0.4082	1.05e-04	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
7	7t7u:C	70	56	0.3194	0.3286	0.4107	1.56e-04
8	1qgw:A	76	71	0.3333	0.3158	0.3380	1.59e-04	1xf6:A, 1xg0:A
9	7tja:G	67	58	0.3056	0.3284	0.3793	2.20e-04	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
10	7t8s:B	78	55	0.3194	0.2949	0.4182	4.04e-04	7t8s:F, 7t8s:J, 7t8s:N
11	7t7u:A	81	55	0.2917	0.2593	0.3818	0.001
12	7t8s:D	70	57	0.3194	0.3286	0.4035	0.001	7t8s:H, 7t8s:L, 7t8s:P
13	7sut:A	78	45	0.2778	0.2564	0.4444	0.004	7sut:E
14	4lms:A	80	47	0.2639	0.2375	0.4043	0.016
15	1qgw:B	67	21	0.1806	0.1940	0.6190	0.041	1xf6:B, 1xg0:B
16	5yge:A	169	44	0.1944	0.0828	0.3182	0.35	6add:A, 6add:B, 5yge:B, 5yo2:A, 5yo2:B
17	3qkt:A	339	43	0.1806	0.0383	0.3023	0.67	4ncj:C, 4ncj:D, 3qkt:C
18	1fsu:A	475	60	0.2917	0.0442	0.3500	4.7
19	5ixg:B	169	22	0.1667	0.0710	0.5455	5.8	5ixg:C, 5ixg:A, 5ixg:D
20	6nwz:A	665	43	0.1944	0.0211	0.3256	7.1

[Back]