AMIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAA
IHRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4chg:A | 133 | 133 | 1.0000 | 1.0000 | 1.0000 | 1.10e-92 | 4chg:B, 4chg:E, 4chg:D, 4chg:F |
2 | 3h87:A | 136 | 46 | 0.1353 | 0.1324 | 0.3913 | 0.21 | |
3 | 8af2:A | 123 | 74 | 0.1353 | 0.1463 | 0.2432 | 0.62 | 8af2:B, 8af3:A, 1ikt:A, 6z1w:A, 6z1x:A |
4 | 6qyc:B | 608 | 81 | 0.1654 | 0.0362 | 0.2716 | 2.7 | 6qyc:A, 6qyc:C, 6r2q:C |
5 | 5lf2:A | 302 | 32 | 0.1128 | 0.0497 | 0.4688 | 3.2 | 5lf2:B |
6 | 6sga:F7 | 662 | 20 | 0.0752 | 0.0151 | 0.5000 | 3.5 | 7pua:F7, 7pub:F7, 6sgb:F7 |
7 | 3tl1:A | 158 | 28 | 0.0977 | 0.0823 | 0.4643 | 3.6 | 3tl1:B |