ALALDTPLPTPSGWTTMGDVAVGDHLLGPDGEPTRVVADTDVMLGRPCYVVEFSDGTAIVADAQHQWPTEHGVRITANLR
AGMHTVVSLAPAVQITAVRRRPSVPVRCVEVDNPEHLYLAGPGMVPTHN
The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6own:B | 129 | 129 | 1.0000 | 1.0000 | 1.0000 | 1.56e-91 | 6own:A, 6own:C |
2 | 8r6s:E | 1091 | 32 | 0.0930 | 0.0110 | 0.3750 | 0.61 | 8rdj:E |
3 | 6hqv:A | 1555 | 89 | 0.1938 | 0.0161 | 0.2809 | 1.2 | 6hqv:B |
4 | 5d4c:K | 231 | 93 | 0.2171 | 0.1212 | 0.3011 | 4.0 | 2a68:A, 2a68:B, 2a68:K, 2a68:L, 2a69:A, 2a69:B, 2a69:K, 2a69:L, 5d4c:B, 5d4c:L, 5d4d:L, 5e17:B, 5e18:B, 7eh0:B, 7eh1:B, 4g7h:B, 1iw7:A, 1iw7:B, 1iw7:K, 1iw7:L, 6kqd:B, 6kqd:K, 6kqe:B, 6kqf:B, 6kqg:B, 6kqh:B, 6kqm:B, 6kqn:B, 6l74:B, 6lts:B, 7mlb:B, 7mli:B, 7mlj:B, 4oin:B, 4oip:B, 7rdq:B, 1smy:A, 1smy:B, 5vo8:B, 8w8n:B, 8w8o:B, 8w8p:B, 5x21:A, 5x22:B, 5x22:L |
5 | 8wa1:c | 1176 | 31 | 0.0775 | 0.0085 | 0.3226 | 4.1 | |
6 | 2owt:A | 315 | 55 | 0.1163 | 0.0476 | 0.2727 | 6.3 | 2ows:A |
7 | 3zyy:X | 628 | 95 | 0.2016 | 0.0414 | 0.2737 | 6.8 | 4c1n:J, 4c1n:I, 4c1n:K, 4c1n:X, 3zyy:Y |
8 | 3acl:A | 288 | 38 | 0.0930 | 0.0417 | 0.3158 | 7.7 | 4ero:A, 4ewa:A, 4ewd:A, 4ewe:A, 4gul:A, 6h1h:A, 6h1i:A, 4hlt:A, 1j1l:A, 5jct:A, 6n0j:A, 6n0k:A |