AKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSNPAIPPVIDLEKIK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5gan:B | 1781 | 71 | 1.0000 | 0.0399 | 1.0000 | 4.83e-43 | 4bgd:A, 5gao:B, 5gap:B, 5nrl:B, 5zwm:D, 5zwo:D |
| 2 | 1a8h:A | 500 | 20 | 0.1408 | 0.0200 | 0.5000 | 7.9 | 2d54:A, 2d5b:A, 3vu8:A, 1woy:A |
umich.edu