AKPPYTFRTGWALLLLAVNFLVAAYYFHIIQ
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tcl:X1 | 39 | 30 | 0.9677 | 0.7692 | 1.0000 | 4.36e-16 | 6k61:X, 6k61:x, 6tcl:X2, 6tcl:X, 6tcl:XX |
2 | 7vcf:F | 402 | 15 | 0.2903 | 0.0224 | 0.6000 | 1.9 | 7xzi:9, 7xzj:9 |
3 | 9fmd:R | 328 | 16 | 0.2581 | 0.0244 | 0.5000 | 2.9 | 8ro2:R |
4 | 8i0u:R | 380 | 14 | 0.2581 | 0.0211 | 0.5714 | 3.0 | 8c6j:K, 8i0s:R, 8i0t:R, 8i0v:R, 8i0w:R, 6icz:R, 6id0:R, 6id1:R, 5mqf:C, 6qdv:K, 7w59:R, 7w5a:R, 7w5b:R, 5xjc:R, 5yzg:R, 6zym:C |
5 | 8k0e:A | 646 | 25 | 0.3548 | 0.0170 | 0.4400 | 5.0 | 8k0f:A, 8k0m:A, 8k17:A, 8kc9:A |
6 | 7cvx:B | 220 | 23 | 0.3548 | 0.0500 | 0.4783 | 7.0 | 7cvv:A, 7cvv:B, 7cvv:C, 7cvw:A, 7cvw:B, 7cvx:A |
7 | 3hns:L | 214 | 12 | 0.2581 | 0.0374 | 0.6667 | 9.2 | 3hnt:L, 3hnv:L |