AKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRC
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d7d:K | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 2.71e-47 | |
2 | 6tgh:A | 410 | 52 | 0.2535 | 0.0439 | 0.3462 | 0.62 | 6tgh:C, 6tgh:B, 6tgh:D, 6ti1:A, 6ti1:C, 6ti3:A, 6ti3:C, 6ti3:B, 6ti3:D, 6ti4:A, 6ti4:C, 4wxf:A, 4wxf:C, 4wxg:A, 4wxg:C, 6yrw:A, 6yrw:C, 6yrw:B, 6yrw:D |
3 | 7s0m:B | 305 | 47 | 0.1690 | 0.0393 | 0.2553 | 2.2 | 7s0m:A |
4 | 3ut1:A | 313 | 53 | 0.2535 | 0.0575 | 0.3396 | 2.6 | 4fl6:A, 4fl6:B, 4l59:A |
5 | 7dde:A | 525 | 64 | 0.2394 | 0.0324 | 0.2656 | 5.2 | 7dde:C, 7dde:E, 7dde:G, 7dde:I, 7dde:K, 7dde:M, 7dde:O, 7dde:Q, 7dde:S, 7dde:V, 7dde:X |
6 | 3k9b:C | 453 | 71 | 0.2817 | 0.0442 | 0.2817 | 5.8 | |
7 | 3hqf:A | 173 | 28 | 0.1690 | 0.0694 | 0.4286 | 6.4 | |
8 | 6gw4:A | 307 | 19 | 0.1408 | 0.0326 | 0.5263 | 9.3 |