AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVV
VRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIIL
VDFKLEFGKDKDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
The query sequence (length=225) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4o7n:A | 233 | 227 | 1.0000 | 0.9657 | 0.9912 | 4.67e-160 | 4o7l:A, 4o7r:A, 4o7s:A, 4o7t:A, 4o7v:A, 4o7w:A, 4o7y:A, 4o7z:A, 4o81:A, 4o81:B, 4o82:A, 4o82:B, 4o83:A, 4o83:B, 4o84:A, 4o84:B, 4o86:A, 3u54:A, 3u54:B |
2 | 3nua:B | 237 | 221 | 0.5067 | 0.4810 | 0.5158 | 1.28e-73 | 3nua:A |
3 | 2z02:A | 242 | 221 | 0.5200 | 0.4835 | 0.5294 | 3.90e-72 | 2yzl:A, 2z02:B |
4 | 2ywv:A | 237 | 225 | 0.5111 | 0.4852 | 0.5111 | 1.79e-69 | 2ywv:B |
5 | 4fe2:B | 235 | 222 | 0.4622 | 0.4426 | 0.4685 | 1.73e-59 | 4fe2:A, 4fgr:A, 4fgr:B, 4nye:A, 4nye:B |
6 | 2gqr:A | 237 | 211 | 0.4044 | 0.3840 | 0.4313 | 6.09e-54 | 2gqr:B, 2gqs:A, 2gqs:B |
7 | 7ale:A | 419 | 200 | 0.3067 | 0.1647 | 0.3450 | 1.88e-26 | 7ale:B, 6yb8:A, 6yb8:B, 6yb9:A, 6yb9:B |
8 | 1obg:A | 305 | 241 | 0.3200 | 0.2361 | 0.2988 | 1.27e-19 | 2cnq:A, 2cnu:A, 2cnv:A, 1obd:A |
9 | 6yx3:A | 297 | 273 | 0.3378 | 0.2559 | 0.2784 | 1.28e-16 | 6yy6:A, 6yy7:A, 6yy8:A, 6yy9:A, 6yya:A, 6yyb:A, 6yyc:A, 6yyd:A, 6z0q:A, 6z0r:A |
10 | 3l2n:A | 376 | 96 | 0.1067 | 0.0638 | 0.2500 | 0.11 | 3l2n:B |
11 | 3l76:A | 585 | 59 | 0.0756 | 0.0291 | 0.2881 | 1.0 | 3l76:B |
12 | 6pt4:B | 473 | 59 | 0.0800 | 0.0381 | 0.3051 | 1.4 | 6pt4:A, 6pt6:B, 6pt6:A, 6pt9:A, 6pt9:B, 6ptk:A, 6ptk:B, 6ptk:C, 6ptk:D |
13 | 1ynp:B | 298 | 100 | 0.1333 | 0.1007 | 0.3000 | 1.8 | 1ynp:A, 1ynq:A, 1ynq:B |
14 | 7d80:5 | 432 | 27 | 0.0533 | 0.0278 | 0.4444 | 2.1 | 7d6z:h, 1w2b:5 |
15 | 5lu4:A | 850 | 28 | 0.0578 | 0.0153 | 0.4643 | 3.1 | 5lu4:B |
16 | 5jvl:A | 874 | 28 | 0.0578 | 0.0149 | 0.4643 | 3.1 | 5jvj:A, 5jvl:C, 5jvl:D, 5jvn:A |
17 | 5th5:A | 241 | 79 | 0.0844 | 0.0788 | 0.2405 | 4.6 | 5tgs:A, 5tgs:B, 5th5:B, 5th5:C, 5th5:D |
18 | 4ewv:B | 492 | 69 | 0.0756 | 0.0346 | 0.2464 | 6.8 | 4ewv:A |
19 | 4epm:A | 554 | 69 | 0.0756 | 0.0307 | 0.2464 | 6.8 | 4eq4:A, 4eq4:B, 4eql:A, 4eql:B, 4l39:A, 4l39:B, 6oms:A, 6oms:B |
20 | 9bh5:Cd | 105 | 50 | 0.0711 | 0.1524 | 0.3200 | 7.0 | 9cai:Cd |
21 | 4pet:A | 329 | 55 | 0.0844 | 0.0578 | 0.3455 | 8.5 | 4pet:B |
22 | 4hlu:C | 249 | 42 | 0.0711 | 0.0643 | 0.3810 | 8.6 | 4hlu:D, 4zir:B |
23 | 4prl:A | 330 | 85 | 0.0978 | 0.0667 | 0.2588 | 9.0 | 4prl:B |
24 | 3haz:A | 983 | 55 | 0.0800 | 0.0183 | 0.3273 | 9.9 | 6bsn:A, 6bsn:B, 3haz:B, 4q71:A, 4q71:B, 4q72:A, 4q72:B, 4q73:A, 4q73:B |