AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPY
KISTTTNCNTVKF
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5lqv:A | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 9.02e-62 | |
2 | 1fk6:A | 93 | 92 | 0.5806 | 0.5806 | 0.5870 | 1.11e-31 | 1fk7:A |
3 | 1rzl:A | 91 | 90 | 0.5591 | 0.5714 | 0.5778 | 1.40e-31 | 1uvc:A, 1uvc:B |
4 | 1bwo:A | 90 | 90 | 0.5376 | 0.5556 | 0.5556 | 3.50e-31 | 1bwo:B, 1cz2:A |
5 | 3gsh:A | 91 | 90 | 0.5054 | 0.5165 | 0.5222 | 1.99e-30 | 3gsh:B, 1jtb:A, 1mid:A |
6 | 6iwo:A | 92 | 91 | 0.4301 | 0.4348 | 0.4396 | 9.73e-22 | 6iwo:B, 6iwp:A, 5tvi:W, 7w9a:A |
7 | 3ktc:A | 330 | 55 | 0.1828 | 0.0515 | 0.3091 | 0.072 | 3ktc:B |
8 | 8fkp:NQ | 324 | 73 | 0.2258 | 0.0648 | 0.2877 | 1.7 | 8fkr:NQ, 8fkt:NQ, 8fkv:NQ |
9 | 8r9b:A | 301 | 25 | 0.0860 | 0.0266 | 0.3200 | 4.7 | 7b5o:J, 7b5q:J, 8orm:J, 8p4z:A, 8p4z:B, 8p6v:J, 8p6w:J, 8p6x:J, 8p6y:J, 8p6z:J, 8p70:J, 8p71:J, 8p72:J, 8p73:J, 8p74:J, 8p75:J, 8p76:J, 8p77:J, 8p78:J, 8p7l:J, 8plz:J, 8r99:A, 8r9a:A, 8r9b:B, 8r9b:C, 8r9b:D, 8r9o:A, 8r9o:B, 8r9s:A, 8r9s:B, 8r9u:A, 8r9u:B, 1ua2:A, 1ua2:B, 1ua2:C, 1ua2:D, 6xbz:J, 6xd3:J |