BioLiP

>protein
AHEILIAETEAFLKNVAPETRTAIISAITGGKSACKSAAKLIKNEHLPLMSGEATTMHIVMRCLYPEIKPWKKASDMLNK
ATSSLKKSEGRDIRKQMKAAGDFLGVESMMKMRAFRDDQIMEMVEEVYDHPDDYTPDIRIGTITAWLRCKNKKS

The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5m1m:A	154	154	1.0000	1.0000	1.0000	1.93e-114
2	5u8c:B	283	38	0.0714	0.0389	0.2895	0.54	2a5s:A, 2a5t:B, 5dex:B, 5h8f:A, 5h8h:A, 5h8n:A, 5h8q:A, 5i2k:A, 5i2n:A, 5i56:B, 5i57:B, 5i58:B, 5i59:B, 5jty:B, 4jwx:A, 5kcj:A, 5kdt:A, 4nf4:B, 4nf5:B, 4nf6:B, 4nf8:B, 6odl:A, 6odl:B, 6ovd:B, 6ove:B, 5tp9:A, 5tpa:A, 6usu:B, 6usv:B, 6uz6:B, 6uzg:B, 6uzr:B, 6uzw:B, 6uzx:B, 5vih:B, 5vii:B, 5vij:B
3	7eor:A	745	26	0.0584	0.0121	0.3462	1.7	7eor:C, 7yfi:B
4	7eoq:A	783	26	0.0584	0.0115	0.3462	1.8	7eoq:C, 7eou:A, 7eou:C, 7eu7:B, 7eu7:D, 5tpw:B, 5tq2:B
5	5uow:B	795	36	0.0779	0.0151	0.3333	2.4
6	6nmx:A	350	40	0.0909	0.0400	0.3500	3.1	6cgq:A, 6cgq:B, 6nmx:B, 6nmx:C, 6nmx:D
7	6cyz:A	295	32	0.0519	0.0271	0.2500	3.7	6cyz:B
8	9are:B	789	26	0.0519	0.0101	0.3077	3.8	9are:D, 9arf:B, 9arf:D, 9ari:B, 9ari:D, 9bib:B, 9bib:D, 6e7r:B, 6e7r:D, 6e7s:B, 6e7s:D, 6e7t:B, 6e7t:D, 6e7u:B, 6e7u:D, 6e7v:B, 6e7v:D, 6e7w:B, 6e7w:D, 6e7x:B, 6e7x:D, 5ewj:B, 5ewj:D, 5ewl:B, 5ewl:D, 5ewm:B, 5ewm:D, 8g18:B, 8g18:D, 3jpy:A, 3qel:B, 3qel:D, 3qem:B, 3qem:D, 7saa:B, 7saa:D, 7sac:B, 7sac:D, 6whu:B, 6whu:D, 6whv:B, 6whv:D, 6whw:B, 6whw:D, 6whx:B, 6whx:D
9	4pe5:D	727	26	0.0519	0.0110	0.3077	3.9	4pe5:B
10	4tll:D	757	26	0.0519	0.0106	0.3077	4.3	4tll:B, 4tlm:B, 5un1:B
11	4tlm:D	753	26	0.0519	0.0106	0.3077	4.3
12	5iov:B	798	26	0.0519	0.0100	0.3077	4.3	5iou:B, 5iou:D, 5iov:D, 5un1:D, 5un1:H

[Back]