AFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRAAIWRGFYIAGDPALAYGYAQD
QEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERT
VVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPR
The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6edg:A | 213 | 208 | 0.9610 | 0.9249 | 0.9471 | 4.54e-138 | 1aer:A, 1aer:B, 3b78:B, 3b78:D, 3b78:F, 3b82:B, 3b82:D, 3b82:F, 3b8h:B, 3b8h:D, 3b8h:F, 1dma:A, 1dma:B, 1xk9:A, 1xk9:B, 2zit:B, 2zit:D, 2zit:F, 1zm4:B, 1zm4:D, 1zm4:F, 1zm9:B, 1zm9:D, 1zm9:F |
2 | 3q9o:A | 605 | 199 | 0.3951 | 0.1339 | 0.4070 | 1.66e-35 | 3ess:A, 3ki0:A, 3ki1:A, 3ki2:A, 3ki3:A, 3ki4:A, 3ki5:A, 3ki6:A, 3ki7:A, 3ny6:A, 2q6m:A |
3 | 9biw:B | 528 | 135 | 0.1756 | 0.0682 | 0.2667 | 0.22 | 9biw:A |
4 | 6vvo:A | 448 | 79 | 0.0976 | 0.0446 | 0.2532 | 1.8 | |
5 | 7dsu:B | 420 | 64 | 0.0976 | 0.0476 | 0.3125 | 4.6 | 7dsu:A |
6 | 1ddt:A | 523 | 135 | 0.1756 | 0.0688 | 0.2667 | 5.6 | 4ae1:A, 4ae1:B, 1dtp:A, 1f0l:A, 1f0l:B, 8g0g:A, 8g0g:B, 1mdt:A, 1mdt:B, 7o4w:A, 1tox:A, 1tox:B |