ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1n89:A | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 1.61e-44 | 1tuk:A |
2 | 1tg7:A | 971 | 45 | 0.2388 | 0.0165 | 0.3556 | 2.0 | 1xc6:A |
3 | 3gsh:A | 91 | 25 | 0.1493 | 0.1099 | 0.4000 | 2.6 | 3gsh:B, 1jtb:A, 1mid:A |
4 | 8h2j:A | 92 | 31 | 0.1791 | 0.1304 | 0.3871 | 4.5 | 8h2j:B, 8h2j:C, 8h2j:D, 8h2j:E, 8h2j:F, 8h39:A, 8h39:B, 8h39:C, 8h39:D, 8h39:E, 8h39:F, 8ixz:A, 8ixz:B, 8ixz:C, 8ixz:D, 8ixz:E, 8ixz:F, 8iy0:A, 8iy0:B, 8iy0:C, 8iy0:D, 8iy0:E, 8iy0:F, 8iy1:A, 8iy1:B, 8iy1:C, 8iy1:D, 8iy1:E, 8iy1:F, 8iy2:A, 8iy2:B, 8iy2:C, 8iy2:D, 8iy2:E, 8iy2:F, 8j8o:A, 8j8o:B, 8j8o:C, 8j8o:D, 8j8o:E, 8j8o:F |
5 | 3esf:A | 197 | 27 | 0.1343 | 0.0457 | 0.3333 | 6.0 | 3esf:B, 3esf:C, 3esf:D |
6 | 6nbr:A | 316 | 16 | 0.1343 | 0.0285 | 0.5625 | 7.1 | 6nbr:B, 6nbr:C, 6nbr:D |