ACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPMAR
RHQRVPMMP
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vsp:C | 92 | 89 | 1.0000 | 0.9674 | 1.0000 | 5.09e-59 | 7vsp:A, 7vsp:B |
2 | 7wsj:A | 93 | 88 | 0.8090 | 0.7742 | 0.8182 | 4.24e-49 | 7vsq:A, 7vsq:B, 7vsq:C, 7wsj:B, 7wsj:C |
3 | 7wsj:A | 93 | 43 | 0.2472 | 0.2366 | 0.5116 | 1.27e-07 | 7vsq:A, 7vsq:B, 7vsq:C, 7wsj:B, 7wsj:C |
4 | 6iv9:A | 874 | 28 | 0.1124 | 0.0114 | 0.3571 | 2.9 | 6iv8:A, 6iv8:C |
5 | 6bml:B | 294 | 36 | 0.1461 | 0.0442 | 0.3611 | 3.1 | 6bml:A, 6bmm:A, 6bmm:B, 6bmn:A, 6bmn:B, 7khm:A, 7khm:B |
6 | 6hif:G | 531 | 40 | 0.1461 | 0.0245 | 0.3250 | 3.6 | 6hif:I, 6hif:H, 6hif:A, 6hif:C, 6hif:B, 6hif:D, 6hif:F, 6hif:E, 6hif:J, 6hif:L, 6hif:K, 6hif:M, 6hif:O, 6hif:N, 6hif:P, 6hif:R, 6hif:Q, 6hif:S, 6hif:U, 6hif:T, 6hif:V, 6hif:X, 6hif:W |
7 | 6lod:B | 929 | 33 | 0.1461 | 0.0140 | 0.3939 | 5.2 | 6loe:B |
8 | 3h0l:B | 410 | 53 | 0.1910 | 0.0415 | 0.3208 | 7.6 | 3h0l:E, 3h0l:H, 3h0l:K, 3h0l:N, 3h0l:Q, 3h0l:T, 3h0l:W, 3h0m:B, 3h0m:E, 3h0m:H, 3h0m:K, 3h0m:N, 3h0m:Q, 3h0m:T, 3h0m:W, 3h0r:B, 3h0r:E, 3h0r:H, 3h0r:K, 3h0r:N, 3h0r:Q, 3h0r:T, 3h0r:W |