AAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSS
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2xcm:E | 74 | 74 | 1.0000 | 1.0000 | 1.0000 | 1.38e-52 | 2xcm:F |
2 | 2yrt:A | 75 | 63 | 0.4189 | 0.4133 | 0.4921 | 1.24e-19 | |
3 | 2bum:B | 238 | 38 | 0.1216 | 0.0378 | 0.2368 | 1.7 | 2buq:B, 2bur:B, 2but:B, 2buu:B, 2buv:B, 2buw:B, 2bux:B, 2buy:B, 2buz:B, 2bv0:B, 1eo2:B, 1eo9:B, 1eoa:B, 1eob:B, 1eoc:B |
4 | 8hmc:B | 1195 | 32 | 0.1622 | 0.0100 | 0.3750 | 4.3 | 8hmd:B |
5 | 6pe2:A | 456 | 34 | 0.1486 | 0.0241 | 0.3235 | 8.7 | 6p5a:A, 6p5a:G, 6pe2:G |
6 | 4kxf:P | 866 | 22 | 0.1081 | 0.0092 | 0.3636 | 9.2 | |
7 | 4kxf:K | 904 | 22 | 0.1081 | 0.0088 | 0.3636 | 9.3 | 4kxf:B, 4kxf:D, 4kxf:F, 4kxf:H, 4kxf:L, 4kxf:N |