AATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAKNFLFLRLWDRNMDI
AMGWKGAQAMQFGQPLVFDMAYENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKL
LLTSTEKSHVDLFPKDSIIYLTADSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNK
NLTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFL
The query sequence (length=276) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8cbk:F | 343 | 294 | 1.0000 | 0.8047 | 0.9388 | 0.0 | 8cbl:F, 8cbm:F, 8cbo:E, 5nfj:A, 5nfj:B, 5nfj:C, 7onu:F |
2 | 4jwf:A | 187 | 177 | 0.1848 | 0.2727 | 0.2881 | 1.15e-16 | 4jwf:B, 4jwh:A, 4jwh:B |
3 | 4jwj:A | 193 | 188 | 0.1703 | 0.2435 | 0.2500 | 1.59e-13 | 4jwj:B |
4 | 4fmw:A | 178 | 181 | 0.1667 | 0.2584 | 0.2541 | 7.31e-13 | 4fmw:B |
5 | 2nvo:A | 496 | 81 | 0.0906 | 0.0504 | 0.3086 | 0.32 | |
6 | 6esq:A | 392 | 97 | 0.0942 | 0.0663 | 0.2680 | 0.46 | 6esq:B, 6esq:C, 6esq:D |
7 | 8oyf:A | 310 | 34 | 0.0471 | 0.0419 | 0.3824 | 1.4 | 8oyg:A, 3zux:A, 3zuy:A |
8 | 4gcz:B | 378 | 45 | 0.0543 | 0.0397 | 0.3333 | 1.8 | 4gcz:A |
9 | 2ynm:D | 488 | 54 | 0.0833 | 0.0471 | 0.4259 | 4.0 | |
10 | 8p0u:A | 621 | 95 | 0.0870 | 0.0386 | 0.2526 | 4.9 | 8p0b:A, 8p0g:A, 8z85:A, 8z8j:A, 8z8n:A, 8z8x:A, 8z90:A, 8z97:A, 8z98:A, 8z9h:A, 8z9h:H, 8z9q:A, 8z9r:A, 8z9r:H |
11 | 5uid:A | 367 | 48 | 0.0543 | 0.0409 | 0.3125 | 6.6 | 5uid:D |
12 | 4hxg:F | 614 | 62 | 0.0652 | 0.0293 | 0.2903 | 7.4 | 4hxe:B, 4hxf:B, 4hxg:A, 4hxg:B, 4hxg:C, 4hxg:D, 4hxg:E, 4hxg:G, 4hxg:H, 4hxg:I, 4hxg:L |
13 | 7zr1:D | 780 | 123 | 0.0906 | 0.0321 | 0.2033 | 9.8 | 7zr1:C |