AATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKADDDDFMHSETREKELESIDVLLEQ
TTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILK
ELSNLETLY
The query sequence (length=169) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5sva:D | 178 | 169 | 0.9290 | 0.8820 | 0.9290 | 3.19e-108 | 7ui9:D, 7uif:D, 7uio:AD, 7uio:BD |
2 | 2e87:A | 356 | 59 | 0.1065 | 0.0506 | 0.3051 | 2.1 | |
3 | 2blf:B | 81 | 38 | 0.0710 | 0.1481 | 0.3158 | 3.7 | 2bpb:B, 2c9x:B, 2ca3:B, 2ca4:B |
4 | 5o1l:A | 375 | 85 | 0.1183 | 0.0533 | 0.2353 | 4.2 | 5o1l:B, 5o1m:A, 5o1m:B |
5 | 7e2s:A | 233 | 99 | 0.1657 | 0.1202 | 0.2828 | 4.3 | 7e2t:A, 7e2u:A, 4xkb:A, 4xkc:A |
6 | 5yjg:A | 594 | 39 | 0.1006 | 0.0286 | 0.4359 | 4.9 | 5yjh:A |
7 | 7yg7:A | 414 | 34 | 0.0710 | 0.0290 | 0.3529 | 7.9 | 7yg7:B, 7yg7:C, 7yg7:D, 7yg7:E, 7yg7:F, 7yg7:G, 7yg7:H, 7yg7:I, 7yg7:J, 7yg7:K |