BioLiP

>protein
AAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHL
TALEMLTAFASHIRAR

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8oir:Bb	101	96	1.0000	0.9505	1.0000	8.39e-68	6gaw:Bp, 6gb2:Bp, 7nqh:Bp, 7nql:Bp, 7nsh:Bp, 7nsi:Bp, 7nsj:Bp, 7o9m:k, 7of6:k, 8oit:Bb, 8pk0:k, 7qi5:k, 8xt0:L3, 8xt1:L3, 6ydp:Bp, 6ydw:Bp, 6zm5:k
2	6xyw:AJ	81	57	0.1771	0.2099	0.2982	0.001
3	4g2c:B	463	70	0.2083	0.0432	0.2857	0.27	4g2c:A
4	3ah5:A	215	40	0.1667	0.0744	0.4000	2.0	3ah5:C, 3ah5:B, 3ah5:D, 3ah5:E, 3ah5:F, 3n3y:A, 3n3y:B, 3n3y:C, 3n3y:D
5	7tbm:X1	620	24	0.0833	0.0129	0.3333	2.1
6	3zzm:A	520	28	0.1354	0.0250	0.4643	2.2	4a1o:A, 4a1o:B
7	8afz:B	376	38	0.1562	0.0399	0.3947	4.4	8a1g:D, 5tgh:A, 5tgh:E, 5tgh:C, 5tgh:G, 5tgi:A, 5tgi:B, 5tgj:A, 5tgj:C, 5tp1:A, 5tp1:B, 5tp1:C, 5tp1:D, 5wy2:A, 5wy2:C
8	6hn0:A	583	53	0.1458	0.0240	0.2642	5.8	6hn1:A, 4jk4:A, 4jk4:B, 8kfo:B, 4luf:A, 4luh:A, 4or0:A, 4or0:B, 5orf:A, 5orf:B, 5orf:C, 5orf:D, 5osw:A, 5otb:A, 5otb:B, 5otb:C, 5otb:D, 6qs9:A, 6qs9:B, 6rjv:A, 6rjv:B, 3v03:A, 3v03:B, 8wdd:A, 8wdd:B
9	8twg:B	385	34	0.1354	0.0338	0.3824	6.0
10	8oun:A	181	38	0.1354	0.0718	0.3421	7.4	8oum:A, 8oum:B, 8oum:C, 8oum:D, 8oum:E, 8oun:B

[Back]