Structure of PDB 6kgx Chain zE

Receptor sequence

>6kgxzE (length=370) Species: 35688 (Porphyridium purpureum)

VPFSTAVRFESPSGGLDRYSRVDPAAPGPNVITRFLFKDRPVRRSDPSLS
EVDREATMRTVYRNVMGNAYVMEEERAELATLESQFLVGAISTRDFVRGV
AKSATYKKRFFESVSQFRFIELNFKHFMGRAPLDMAEMSKHYEIFAAGGY
DAEVDSYFDSEEYLDVFGLDTVPYMRFRGTYAPNSTFNLQCRLQGGWARS
DKKLPMMSMLPLNNKAAIMPHQIVDGLPVIPNSEHPSQKYNVPKVSREKL
QRELLIAQGKANALQIELDAAYTSLASSRAFLAPFAAMAADMDIRPLYGK
NPQVFAGQFLGVGAGQWGKTGADTVRGRSRRVAADIGVKEFQLERVKQLV
VDLQRALALEDAEADAPATS

3D structure

• PDB: 6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
• Chain: zE
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	zE	T116 S119	T81 S84
BS02	PEB	zE	Q151 S174 Y177	Q116 S139 Y142
BS03	PEB	zE	Y54 P59	Y19 P24
BS04	PEB	zE	T215 Y216 N219	T180 Y181 N184
BS05	PEB	zE	A233 S235 K237	A198 S200 K202

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 19:50:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kgx', asym_id = 'zE', title = 'Structural basis of energy transfer in Porphyridium purpureum phycobilisome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kgx', asym_id='zE', title='Structural basis of energy transfer in Porphyridium purpureum phycobilisome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '6kgx', asym_id = 'zE'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='6kgx', asym_id='zE')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>