Structure of PDB 7y5e Chain z6 |
>7y5ez6 (length=60) Species: 35688 (Porphyridium purpureum) [Search protein sequence] |
MVTALQILVFALTILSTILVVSIPVILASPGQWEQSKNLVFTGAGVWSGL VIVTGLLNSF |
|
PDB | 7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex. |
Chain | z6 |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
z6 |
V20 P24 |
V20 P24 |
|
|
|
|