Structure of PDB 9evx Chain z |
>9evxz (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] |
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL VLVVGVLNFFVV |
|
PDB | 9evx Cryo-electron microscopy reveals hydrogen positions and water networks in photosystem II |
Chain | z |
Resolution | 1.71 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
z |
I21 A28 S29 D32 |
I21 A28 S29 D32 |
|
|
|
|