Structure of PDB 8pk0 Chain z

Receptor sequence

>8pk0z (length=311) Species: 9606 (Homo sapiens)

WRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGR
NPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVK
DENVKQIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRR
QHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVE
TGLKLALCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNV
ERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPAAARDFLQTFRRGLLG
SVMLDLDVLRG

3D structure

• PDB: 8pk0 Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
• Chain: z
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	R29 W30 P32 G33 K37 G171 K172 A173 R175 G177 A185 M187 K189 I190 R210 H229 Q280 K281 K283 Q307	R14 W15 P17 G18 K22 G156 K157 A158 R160 G162 A170 M172 K174 I175 R195 H214 Q265 K266 K268 Q292
BS02	GNP	z	N83 K84 D86 L87 N112 N153 G155 K156 S157 S158 V176 G177 G181 I182 T183	N68 K69 D71 L72 N97 N138 G140 K141 S142 S143 V161 G162 G166 I167 T168
BS03	MG	z	S157 T183	S142 T168

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006417 regulation of translation
• GO:0032543 mitochondrial translation
• GO:0044065 regulation of respiratory system process
• GO:0070129 regulation of mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome

External links

• PDB: RCSB:8pk0, PDBe:8pk0, PDBj:8pk0
• PDBsum: 8pk0
• PubMed: 38042949
• UniProt: Q9BT17|MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 (Gene Name=MTG1)