Structure of PDB 8jsg Chain z

Receptor sequence
>8jsgz (length=79) Species: 562 (Escherichia coli) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB8jsg Initiation factor 3 bound to the 30S ribosomal subunit in an initial step of translation.
Chainz
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z R2 S3 L4 K5 K6 F9 H13 K16 K20 W33 S34 R35 R36 T38 H51 N52 G53 R54 H68 K69 G71 T76 R77 T78 R80 R1 S2 L3 K4 K5 F8 H12 K15 K19 W32 S33 R34 R35 T37 H50 N51 G52 R53 H67 K68 G70 T75 R76 T77 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jsg, PDBe:8jsg, PDBj:8jsg
PDBsum8jsg
PubMed38148682
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]