Structure of PDB 8j6z Chain z

Receptor sequence
>8j6zz (length=227) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
RRTVKSTPQSIWYGPDRPKYLGPFSENTPSYLTGEYPGDYGWDTAGLSAD
PETFAKNRELEVIHSRWAMLGALGCTFPEILSKNGVKFGEAVWFKAGSQI
FSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDP
LYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKG
PIENLFDHLADPVANNAWSYATNFVPG
3D structure
PDB8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
Chainz
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0009269 response to desiccation
GO:0009409 response to cold
GO:0009416 response to light stimulus
GO:0009644 response to high light intensity
GO:0009645 response to low light intensity stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0009769 photosynthesis, light harvesting in photosystem II
GO:0010114 response to red light
GO:0010218 response to far red light
GO:0015979 photosynthesis
GO:0042631 cellular response to water deprivation
GO:0071215 cellular response to abscisic acid stimulus
GO:0090333 regulation of stomatal closure
GO:1903428 positive regulation of reactive oxygen species biosynthetic process
Cellular Component
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0009507 chloroplast
GO:0009517 PSII associated light-harvesting complex II
GO:0009522 photosystem I
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum8j6z
PubMed37936349
UniProtQ9SHR7|CB21_ARATH Chlorophyll a-b binding protein 2.1, chloroplastic (Gene Name=LHCB2.1)

[Back to BioLiP]