Structure of PDB 8ipx Chain z

Receptor sequence

>8ipxz (length=67) Species: 9606 (Homo sapiens)

AKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLRNKKTLLDQHGQYPIW
MNQRQRKRLKAKREKRK

3D structure

• PDB: 8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Chain: z
• Resolution: 4.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	A2 K3 S4 L5 S7 W9 R11 M13 R14 K17 R18 N82 K83 K84 H90 G91 Q92 N98 Q99 R104 K106 K111	A1 K2 S3 L4 S6 W8 R10 M12 R13 K16 R17 N36 K37 K38 H44 G45 Q46 N52 Q53 R58 K60 K65

Gene Ontology

Molecular Function

• GO:0001099 basal RNA polymerase II transcription machinery binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0060999 positive regulation of dendritic spine development
• GO:0097484 dendrite extension

Cellular Component

• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005730 nucleolus

External links

• PDB: RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
• PDBsum: 8ipx
• PubMed: 37491604
• UniProt: Q9BRT6|LLPH_HUMAN Protein LLP homolog (Gene Name=LLPH)