Structure of PDB 8crx Chain z

Receptor sequence
>8crxz (length=62) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
AVPKRKMSRSNTRHRRSQWKTVATKLVTCANPACGEKHLPHTACPSCGGY
GPRGDRRQVVEA
3D structure
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Chainz
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z A2 V3 P4 K5 R6 K7 M8 S9 R10 S11 T13 R14 H15 R16 R17 S18 Q19 W20 V28 P41 H42 Y51 G52 P53 A1 V2 P3 K4 R5 K6 M7 S8 R9 S10 T12 R13 H14 R15 R16 S17 Q18 W19 V27 P40 H41 Y50 G51 P52
BS02 ZN z C30 C35 C45 C48 C29 C34 C44 C47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2B7I771

[Back to BioLiP]