Structure of PDB 8cqw Chain z

Receptor sequence

>8cqwz (length=179) Species: 5476 (Candida albicans) [Search protein sequence]

ANLRTQKRLAASVIGVGKRKVWLDPNETTEIANANSRSAIRKLYKNGTIV
KKPETVHSRSRARALKESKRAGRHMGYGKRKGTKDARMPSQVLWMRRLRV
LRKLLAKYRDAGKIDKHLYHNLYKAAKGNTFKHKRSLVEHIIAAKAEALR
EKALKEEAEARRVRNRAARERRQQRLAEK

3D structure

PDB

8cqw Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.05 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	z	A2 N3 L4 R5 T6 R9 G18 K19 R20 K21 W23 L24 P26 S37 R38 S39 R42 K43 K46 E55 T56 V57 H58 S59 R60 S61 R62 A63 R64 K70 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 K85 R88 M89 P90 Q92 W95 M96 R97 L99 R100 V101 R103 K104 R110 G113 K114 K117 H118 Y120 H121 Y124 K125 K128 G129 N130 K135 R136	A1 N2 L3 R4 T5 R8 G17 K18 R19 K20 W22 L23 P25 S36 R37 S38 R41 K42 K45 E54 T55 V56 H57 S58 R59 S60 R61 A62 R63 K69 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 K84 R87 M88 P89 Q91 W94 M95 R96 L98 R99 V100 R102 K103 R109 G112 K113 K116 H117 Y119 H120 Y123 K124 K127 G128 N129 K134 R135
BS02	rna	z	A159 R162 R163 R165 N166 R170 R172 R173 R176	A158 R161 R162 R164 N165 R169 R171 R172 R175
BS03	MG	z	S61 R62	S60 R61

External links

PDB	RCSB:8cqw, PDBe:8cqw, PDBj:8cqw
PDBsum	8cqw
PubMed
UniProt	A0A1D8PK40\|RL19A_CANAL Large ribosomal subunit protein eL19 (Gene Name=RPL19A)

[Back to BioLiP]