Structure of PDB 8agx Chain z

Receptor sequence
>8agxz (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VKYLYLRAVGGELAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQ
NRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQ
MRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIP
3D structure
PDB8agx Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
Chainz
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z L15 R16 A77 S78 K96 N97 V98 T124 V128 E131 T135 A136 S138 V139 L6 R7 A62 S63 K81 N82 V83 T109 V113 E116 T120 A121 S123 V124
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8agx, PDBe:8agx, PDBj:8agx
PDBsum8agx
PubMed36804914
UniProtP0CX53|RL12A_YEAST Large ribosomal subunit protein uL11A (Gene Name=RPL12A)

[Back to BioLiP]