Structure of PDB 7uqz Chain z

Receptor sequence
>7uqzz (length=87) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
AKSLRASSHLNAKSVKRRGVFQKAVDAREQRISDKLKEDLLKQKLEDLKK
KEEQGISTSGWRDGRHHTYKKAKLMKQSKKKTSFTRF
3D structure
PDB7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chainz
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z A2 K3 S4 L5 R6 A7 S8 K14 K17 R18 S78 G79 W80 H85 K89 K92 L93 M94 K95 F103 T104 A1 K2 S3 L4 R5 A6 S7 K13 K16 R17 S59 G60 W61 H66 K70 K73 L74 M75 K76 F84 T85
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum7uqz
PubMed36864048
UniProtP38202|YBC8_YEAST UPF0642 protein YBL028C (Gene Name=YBL028C)

[Back to BioLiP]