Structure of PDB 7rcv Chain z

Receptor sequence
>7rcvz (length=60) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
SIVFQIALAALVLFSFVMVVGVPVAYASPQNWDRSKPLLYLGSGIWAILV
IVVALLNFLV
3D structure
PDB7rcv High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
Chainz
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA z M19 V20 V23 P24 M18 V19 V22 P23
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rcv, PDBe:7rcv, PDBj:7rcv
PDBsum7rcv
PubMed34937700
UniProtP73528|PSBZ_SYNY3 Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]