Structure of PDB 7qiz Chain z

Receptor sequence

>7qizz (length=147) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

AEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATE
GTYIDKKCPFTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRY
EKRHSNIPAHISPCFRVKEGDHVTIGQCRPLSKTVRFNVLKVIPAGS

3D structure

PDB

7qiz Specific features and methylation sites of a plant ribosome

Chain

Resolution

2.38 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	E6 K7 P13 F16 R27 K30 Y35 K37 S38 I39 G40 L41 K58 S66 I67 R68 R70 S78 K80 M81 N82 T84 I86 R89 Y91 H93 K96 K97 Y98 R100 K103 R104 H105 S106 N107 Q128 R130 P131 L132 S133 K134 T135 R137 F138 G147	E5 K6 P12 F15 R26 K29 Y34 K36 S37 I38 G39 L40 K57 S65 I66 R67 R69 S77 K79 M80 N81 T83 I85 R88 Y90 H92 K95 K96 Y97 R99 K102 R103 H104 S105 N106 Q127 R129 P130 L131 S132 K133 T134 R136 F137 G146

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links