Structure of PDB 7pio Chain z

Receptor sequence
>7pioz (length=50) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AVKRSTRLGCNDCREINYLTFKNVKKNPEKLALNKFCSRCRKVVVHKEVK
3D structure
PDB7pio Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainz
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z V3 R5 R8 E16 I17 F22 N24 K26 K27 N28 L34 K36 F37 S39 R42 V2 R4 R7 E15 I16 F21 N23 K25 K26 N27 L33 K35 F36 S38 R41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pio, PDBe:7pio, PDBj:7pio
PDBsum7pio
PubMed36171285
UniProtP78015|RL331_MYCPN Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]