Structure of PDB 7pic Chain z

Receptor sequence
>7picz (length=50) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AVKRSTRLGCNDCREINYLTFKNVKKNPEKLALNKFCSRCRKVVVHKEVK
3D structure
PDB7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainz
Resolution9.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z A2 K4 R8 I17 T21 K27 L34 K36 F37 S39 R42 A1 K3 R7 I16 T20 K26 L33 K35 F36 S38 R41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pic, PDBe:7pic, PDBj:7pic
PDBsum7pic
PubMed36171285
UniProtP78015|RL331_MYCPN Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]