Structure of PDB 7pib Chain z

Receptor sequence
>7pibz (length=50) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AVKRSTRLGCNDCREINYLTFKNVKKNPEKLALNKFCSRCRKVVVHKEVK
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainz
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z K4 R8 Y19 T21 F22 N24 N28 N35 K36 F37 R42 K3 R7 Y18 T20 F21 N23 N27 N34 K35 F36 R41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP78015|RL331_MYCPN Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]