Structure of PDB 7obq Chain z

Receptor sequence
>7obqz (length=62) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
KKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGKGTQ
GATAGASSELDA
3D structure
PDB7obq Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
Chainz
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z K555 K556 K558 K559 K561 N565 P572 R576 W577 P579 M580 K600 G601 K2 K3 K5 K6 K8 N12 P19 R23 W24 P26 M27 K47 G48
Gene Ontology
Molecular Function
GO:0008312 7S RNA binding
GO:0043022 ribosome binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7obq, PDBe:7obq, PDBj:7obq
PDBsum7obq
PubMed34260909
UniProtP33731|SRP72_CANLF Signal recognition particle subunit SRP72 (Gene Name=SRP72)

[Back to BioLiP]