Structure of PDB 6xir Chain z

Receptor sequence
>6xirz (length=185) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLD
SEKHIDFAPTSPFGGARPGRVARRNAARKAEASGE
3D structure
PDB6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
Chainz
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z R3 P5 R6 T7 Y8 S9 T11 P18 Y19 K39 R44 E72 R79 H124 Q131 N142 I143 S145 F146 R149 R171 R174 N176 R2 P4 R5 T6 Y7 S8 T10 P17 Y18 K38 R43 E71 R78 H123 Q130 N141 I142 S144 F145 R148 R170 R173 N175
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0043226 organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xir, PDBe:6xir, PDBj:6xir
PDBsum6xir
PubMed32855298
UniProtO13516|RS9A_YEAST Small ribosomal subunit protein uS4A (Gene Name=RPS9A)

[Back to BioLiP]