Structure of PDB 6s05 Chain z

Receptor sequence
>6s05z (length=58) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RRTITAADRRMVSGVTEKQYKKGMKKMQQLEKNAINTQIRREIKRVNFQT
HYRDELLQ
3D structure
PDB6s05 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
Chainz
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z Y394 K400 Q402 L404 R414 R415 K418 V420 Q423 H425 Y426 R427 D428 E429 L430 L431 Q432 Y20 K26 Q28 L30 R40 R41 K44 V46 Q49 H51 Y52 R53 D54 E55 L56 L57 Q58
BS02 rna z V386 S387 G388 V12 S13 G14
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s05, PDBe:6s05, PDBj:6s05
PDBsum6s05
PubMed31115337
UniProtQ06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 (Gene Name=REH1)

[Back to BioLiP]