Structure of PDB 6ahd Chain z

Receptor sequence

>6ahdz (length=61) Species: 9606 (Homo sapiens)

ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHEEQVVLGLYIV
RGDNVAVIGEI

3D structure

• PDB: 6ahd Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
• Chain: z
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	Q32 T33	Q29 T30

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding
• GO:0017070 U6 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:0120115 Lsm2-8 complex

External links

• PDB: RCSB:6ahd, PDBe:6ahd, PDBj:6ahd
• PDBsum: 6ahd
• PubMed: 30315277
• UniProt: O95777|LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)