Structure of PDB 5ws5 Chain z |
>5ws5z (length=62) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] |
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL VLVVGVLNFFVV |
|
PDB | 5ws5 Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL. |
Chain | z |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
z |
F17 V25 A28 S29 |
F17 V25 A28 S29 |
|
|
|
|