Structure of PDB 5we6 Chain z

Receptor sequence

>5we6z (length=393) Species: 562 (Escherichia coli)

SKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFNQID
NAPEEKARGITINTSHVEYDTPTRHYAHVDCPGAADYVKNMITGAAQMDG
AILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE
MEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIP
EPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKET
QKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKP
HTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMV
MPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLS

3D structure

• PDB: 5we6 Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
• Chain: z
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	H19 V20 R58 M112	H19 V20 R58 M112
BS02	rna	z	G222 R223 R279	G222 R223 R279
BS03	rna	z	A52 E54 N63 Y87 K89 F218 S219 I220 E259 R262 G275 R288 T320 G325 Y326 R327 Q329 T338 H364 E378 G379	A52 E54 N63 Y87 K89 F218 S219 I220 E259 R262 G275 R288 T320 G325 Y326 R327 Q329 T338 H364 E378 G379
BS04	PHE	z	H66 F218 F261 N273	H66 F218 F261 N273
BS05	GTP	z	H19 G23 K24 T25 T61 P82 N135 K136 S173 L175	H19 G23 K24 T25 T61 P82 N135 K136 S173 L175
BS06	MG	z	T25 T61	T25 T61

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:5we6, PDBe:5we6, PDBj:5we6
• PDBsum: 5we6
• PubMed: 29733411
• UniProt: P0CE48|EFTU2_ECOLI Elongation factor Tu 2 (Gene Name=tufB)